Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3359886..3360506 | Replicon | chromosome |
| Accession | NZ_CP123282 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | QEN32_RS16160 | Protein ID | WP_001280991.1 |
| Coordinates | 3360288..3360506 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | QEN32_RS16155 | Protein ID | WP_000344807.1 |
| Coordinates | 3359886..3360260 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS16145 (3355025) | 3355025..3356218 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QEN32_RS16150 (3356241) | 3356241..3359390 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| QEN32_RS16155 (3359886) | 3359886..3360260 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| QEN32_RS16160 (3360288) | 3360288..3360506 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| QEN32_RS16165 (3360685) | 3360685..3361236 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| QEN32_RS16170 (3361354) | 3361354..3361824 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| QEN32_RS16175 (3361880) | 3361880..3362020 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| QEN32_RS16180 (3362026) | 3362026..3362286 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| QEN32_RS16185 (3362511) | 3362511..3364061 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
| QEN32_RS16195 (3364292) | 3364292..3364681 | + | 390 | WP_000961286.1 | MGMT family protein | - |
| QEN32_RS16200 (3364714) | 3364714..3365283 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T278906 WP_001280991.1 NZ_CP123282:3360288-3360506 [Salmonella sp. SA14318]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT278906 WP_000344807.1 NZ_CP123282:3359886-3360260 [Salmonella sp. SA14318]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|