Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2361259..2361781 | Replicon | chromosome |
Accession | NZ_CP123282 | ||
Organism | Salmonella sp. SA14318 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | QEN32_RS11265 | Protein ID | WP_000221345.1 |
Coordinates | 2361497..2361781 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | QEN32_RS11260 | Protein ID | WP_000885424.1 |
Coordinates | 2361259..2361507 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN32_RS11235 (2357317) | 2357317..2358225 | - | 909 | WP_265322119.1 | LysR family transcriptional regulator | - |
QEN32_RS11240 (2358627) | 2358627..2358815 | + | 189 | WP_265322120.1 | DUF29 domain-containing protein | - |
QEN32_RS11245 (2359093) | 2359093..2359410 | - | 318 | WP_109187489.1 | DUF1493 family protein | - |
QEN32_RS11250 (2360101) | 2360101..2360490 | + | 390 | WP_001044696.1 | hypothetical protein | - |
QEN32_RS11255 (2360493) | 2360493..2360846 | + | 354 | WP_000418733.1 | hypothetical protein | - |
QEN32_RS11260 (2361259) | 2361259..2361507 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QEN32_RS11265 (2361497) | 2361497..2361781 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEN32_RS11270 (2361952) | 2361952..2362341 | + | 390 | WP_000194089.1 | RidA family protein | - |
QEN32_RS11275 (2362399) | 2362399..2363472 | - | 1074 | WP_000954681.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
QEN32_RS11280 (2363665) | 2363665..2364153 | - | 489 | WP_265322121.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QEN32_RS11285 (2364198) | 2364198..2365706 | + | 1509 | WP_000199413.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2354445..2368563 | 14118 | |
- | inside | Genomic island | - | - | 2360493..2368563 | 8070 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T278905 WP_000221345.1 NZ_CP123282:2361497-2361781 [Salmonella sp. SA14318]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |