Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1023364..1024178 | Replicon | chromosome |
Accession | NZ_CP123282 | ||
Organism | Salmonella sp. SA14318 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | QEN32_RS04870 | Protein ID | WP_000971655.1 |
Coordinates | 1023364..1023891 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | QEN32_RS04875 | Protein ID | WP_000855694.1 |
Coordinates | 1023888..1024178 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN32_RS04845 (1019566) | 1019566..1019987 | + | 422 | Protein_948 | cytoplasmic protein | - |
QEN32_RS04850 (1020550) | 1020550..1021218 | + | 669 | WP_000445914.1 | hypothetical protein | - |
QEN32_RS04855 (1021245) | 1021245..1021739 | + | 495 | WP_000424944.1 | hypothetical protein | - |
QEN32_RS04860 (1021984) | 1021984..1022640 | - | 657 | WP_076741749.1 | protein-serine/threonine phosphatase | - |
QEN32_RS04865 (1022867) | 1022867..1023291 | + | 425 | Protein_952 | transposase | - |
QEN32_RS04870 (1023364) | 1023364..1023891 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
QEN32_RS04875 (1023888) | 1023888..1024178 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
QEN32_RS04880 (1024772) | 1024772..1025098 | + | 327 | WP_242105757.1 | hypothetical protein | - |
QEN32_RS04885 (1025371) | 1025371..1025718 | - | 348 | WP_242105758.1 | DUF1493 family protein | - |
QEN32_RS04890 (1025703) | 1025703..1026152 | - | 450 | WP_000381619.1 | hypothetical protein | - |
QEN32_RS04895 (1026584) | 1026584..1027027 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
QEN32_RS04900 (1027484) | 1027484..1028134 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1023115..1033447 | 10332 | |
- | flank | IS/Tn | - | - | 1023115..1023291 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T278900 WP_000971655.1 NZ_CP123282:c1023891-1023364 [Salmonella sp. SA14318]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |