Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 854656..855316 | Replicon | chromosome |
| Accession | NZ_CP123282 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QEN32_RS04115 | Protein ID | WP_061377829.1 |
| Coordinates | 854903..855316 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | QEN32_RS04110 | Protein ID | WP_000351186.1 |
| Coordinates | 854656..854922 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS04090 (850584) | 850584..852017 | - | 1434 | WP_001230152.1 | 6-phospho-beta-glucosidase BglA | - |
| QEN32_RS04095 (852176) | 852176..852487 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| QEN32_RS04100 (852651) | 852651..853310 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| QEN32_RS04105 (853426) | 853426..854406 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| QEN32_RS04110 (854656) | 854656..854922 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| QEN32_RS04115 (854903) | 854903..855316 | + | 414 | WP_061377829.1 | protein YgfX | Toxin |
| QEN32_RS04120 (855369) | 855369..855890 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| QEN32_RS04125 (856003) | 856003..856899 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| QEN32_RS04130 (856923) | 856923..857636 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QEN32_RS04135 (857642) | 857642..859375 | + | 1734 | WP_000813380.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16291.30 Da Isoelectric Point: 11.1741
>T278899 WP_061377829.1 NZ_CP123282:854903-855316 [Salmonella sp. SA14318]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGH
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGH
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|