Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 319208..319794 Replicon chromosome
Accession NZ_CP123282
Organism Salmonella sp. SA14318

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag QEN32_RS01480 Protein ID WP_000174963.1
Coordinates 319426..319794 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag QEN32_RS01475 Protein ID WP_165901231.1
Coordinates 319208..319429 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN32_RS01450 (314228) 314228..315337 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QEN32_RS01455 (315397) 315397..316323 + 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QEN32_RS01460 (316320) 316320..317597 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
QEN32_RS01465 (317594) 317594..318361 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QEN32_RS01470 (318363) 318363..319076 + 714 WP_080202932.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QEN32_RS01475 (319208) 319208..319429 + 222 WP_165901231.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QEN32_RS01480 (319426) 319426..319794 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QEN32_RS01485 (320053) 320053..321369 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QEN32_RS01490 (321474) 321474..322361 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QEN32_RS01495 (322358) 322358..323203 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QEN32_RS01500 (323206) 323206..324276 + 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 316320..325013 8693
- inside Prophage - - 312203..325013 12810


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T278898 WP_000174963.1 NZ_CP123282:319426-319794 [Salmonella sp. SA14318]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8138.11 Da        Isoelectric Point: 5.0637

>AT278898 WP_165901231.1 NZ_CP123282:319208-319429 [Salmonella sp. SA14318]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRDLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure

References