Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 203488..204248 | Replicon | chromosome |
Accession | NZ_CP123282 | ||
Organism | Salmonella sp. SA14318 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | QEN32_RS00945 | Protein ID | WP_000533909.1 |
Coordinates | 203763..204248 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | Q8Z2B2 |
Locus tag | QEN32_RS00940 | Protein ID | WP_000965889.1 |
Coordinates | 203488..203775 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN32_RS00930 (200604) | 200604..201032 | + | 429 | Protein_184 | IS3 family transposase | - |
QEN32_RS00935 (202146) | 202146..203012 | - | 867 | WP_031612771.1 | hypothetical protein | - |
QEN32_RS00940 (203488) | 203488..203775 | + | 288 | WP_000965889.1 | DUF1778 domain-containing protein | Antitoxin |
QEN32_RS00945 (203763) | 203763..204248 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
QEN32_RS00950 (204619) | 204619..205158 | - | 540 | WP_000047140.1 | copper-binding periplasmic metallochaperone CueP | - |
QEN32_RS00955 (205331) | 205331..205543 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
QEN32_RS00960 (205831) | 205831..206121 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
QEN32_RS00965 (206560) | 206560..207270 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
QEN32_RS00970 (207320) | 207320..208294 | - | 975 | WP_079944123.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
QEN32_RS00975 (208524) | 208524..209186 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T278897 WP_000533909.1 NZ_CP123282:203763-204248 [Salmonella sp. SA14318]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752RW74 |