Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4224172..4224986 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | QEN30_RS20945 | Protein ID | WP_000971655.1 |
Coordinates | 4224172..4224699 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | QEN30_RS20950 | Protein ID | WP_000855692.1 |
Coordinates | 4224696..4224986 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS20925 (4219472) | 4219472..4222039 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
QEN30_RS20930 (4222198) | 4222198..4222719 | + | 522 | WP_000858988.1 | hypothetical protein | - |
QEN30_RS20935 (4222891) | 4222891..4223547 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
QEN30_RS20940 (4223894) | 4223894..4224099 | + | 206 | Protein_4079 | IS5/IS1182 family transposase | - |
QEN30_RS20945 (4224172) | 4224172..4224699 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
QEN30_RS20950 (4224696) | 4224696..4224986 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
QEN30_RS20955 (4225256) | 4225256..4225434 | - | 179 | Protein_4082 | IS3 family transposase | - |
QEN30_RS20960 (4225675) | 4225675..4226001 | + | 327 | WP_000393302.1 | hypothetical protein | - |
QEN30_RS20965 (4226274) | 4226274..4226621 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
QEN30_RS20970 (4226606) | 4226606..4227055 | - | 450 | WP_000381610.1 | membrane protein | - |
QEN30_RS20975 (4227486) | 4227486..4227929 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
QEN30_RS20980 (4228386) | 4228386..4229036 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 4223923..4234349 | 10426 | |
- | flank | IS/Tn | - | - | 4223923..4224099 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T278895 WP_000971655.1 NZ_CP123280:c4224699-4224172 [Salmonella sp. SA17155]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |