Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4077210..4077835 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | QEN30_RS20290 | Protein ID | WP_000911336.1 |
Coordinates | 4077437..4077835 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | QEN30_RS20285 | Protein ID | WP_000557549.1 |
Coordinates | 4077210..4077437 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS20255 (4072255) | 4072255..4073772 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
QEN30_RS20260 (4073848) | 4073848..4074393 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
QEN30_RS20265 (4074658) | 4074658..4075416 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
QEN30_RS20275 (4075701) | 4075701..4076507 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
QEN30_RS20280 (4076782) | 4076782..4077033 | - | 252 | WP_001540858.1 | hypothetical protein | - |
QEN30_RS20285 (4077210) | 4077210..4077437 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QEN30_RS20290 (4077437) | 4077437..4077835 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QEN30_RS20295 (4078641) | 4078641..4079177 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
QEN30_RS20300 (4079224) | 4079224..4079856 | + | 633 | WP_000835265.1 | YfdX family protein | - |
QEN30_RS20305 (4080575) | 4080575..4081159 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4075701..4087026 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T278894 WP_000911336.1 NZ_CP123280:4077437-4077835 [Salmonella sp. SA17155]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2Y5V5 |