Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4066323..4066983 | Replicon | chromosome |
| Accession | NZ_CP123280 | ||
| Organism | Salmonella sp. SA17155 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | QEN30_RS20225 | Protein ID | WP_000244756.1 |
| Coordinates | 4066570..4066983 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | QEN30_RS20220 | Protein ID | WP_000351186.1 |
| Coordinates | 4066323..4066589 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN30_RS20200 (4062251) | 4062251..4063684 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| QEN30_RS20205 (4063843) | 4063843..4064154 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| QEN30_RS20210 (4064318) | 4064318..4064977 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| QEN30_RS20215 (4065093) | 4065093..4066073 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
| QEN30_RS20220 (4066323) | 4066323..4066589 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| QEN30_RS20225 (4066570) | 4066570..4066983 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| QEN30_RS20230 (4067036) | 4067036..4067557 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| QEN30_RS20235 (4067670) | 4067670..4068566 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| QEN30_RS20240 (4068590) | 4068590..4069303 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QEN30_RS20245 (4069309) | 4069309..4071042 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T278893 WP_000244756.1 NZ_CP123280:4066570-4066983 [Salmonella sp. SA17155]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |