Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3544500..3545086 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | doc | Uniprot ID | E8XF70 |
Locus tag | QEN30_RS17630 | Protein ID | WP_001521773.1 |
Coordinates | 3544718..3545086 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | M7SDJ3 |
Locus tag | QEN30_RS17625 | Protein ID | WP_001520924.1 |
Coordinates | 3544500..3544721 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS17600 (3539520) | 3539520..3540629 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QEN30_RS17605 (3540689) | 3540689..3541615 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QEN30_RS17610 (3541612) | 3541612..3542889 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
QEN30_RS17615 (3542886) | 3542886..3543653 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
QEN30_RS17620 (3543655) | 3543655..3544368 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
QEN30_RS17625 (3544500) | 3544500..3544721 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QEN30_RS17630 (3544718) | 3544718..3545086 | + | 369 | WP_001521773.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QEN30_RS17635 (3545345) | 3545345..3546661 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
QEN30_RS17640 (3546725) | 3546725..3547612 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
QEN30_RS17645 (3547609) | 3547609..3548454 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
QEN30_RS17650 (3548456) | 3548456..3549526 | + | 1071 | WP_000907838.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3541612..3550263 | 8651 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13587.92 Da Isoelectric Point: 7.3190
>T278891 WP_001521773.1 NZ_CP123280:3544718-3545086 [Salmonella sp. SA17155]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A607IPC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z871 |