Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3544500..3545086 Replicon chromosome
Accession NZ_CP123280
Organism Salmonella sp. SA17155

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag QEN30_RS17630 Protein ID WP_001521773.1
Coordinates 3544718..3545086 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag QEN30_RS17625 Protein ID WP_001520924.1
Coordinates 3544500..3544721 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN30_RS17600 (3539520) 3539520..3540629 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QEN30_RS17605 (3540689) 3540689..3541615 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QEN30_RS17610 (3541612) 3541612..3542889 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
QEN30_RS17615 (3542886) 3542886..3543653 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QEN30_RS17620 (3543655) 3543655..3544368 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QEN30_RS17625 (3544500) 3544500..3544721 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QEN30_RS17630 (3544718) 3544718..3545086 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QEN30_RS17635 (3545345) 3545345..3546661 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QEN30_RS17640 (3546725) 3546725..3547612 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QEN30_RS17645 (3547609) 3547609..3548454 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QEN30_RS17650 (3548456) 3548456..3549526 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3541612..3550263 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T278891 WP_001521773.1 NZ_CP123280:3544718-3545086 [Salmonella sp. SA17155]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT278891 WP_001520924.1 NZ_CP123280:3544500-3544721 [Salmonella sp. SA17155]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References