Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3434523..3435283 | Replicon | chromosome |
| Accession | NZ_CP123280 | ||
| Organism | Salmonella sp. SA17155 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q57IH1 |
| Locus tag | QEN30_RS17150 | Protein ID | WP_000533909.1 |
| Coordinates | 3434798..3435283 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | QEN30_RS17145 | Protein ID | WP_000965886.1 |
| Coordinates | 3434523..3434810 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN30_RS17120 (3429818) | 3429818..3430120 | + | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
| QEN30_RS17125 (3430259) | 3430259..3431170 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| QEN30_RS17130 (3431180) | 3431180..3433249 | + | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
| QEN30_RS17135 (3433431) | 3433431..3433706 | + | 276 | Protein_3335 | IS3 family transposase | - |
| QEN30_RS17140 (3433878) | 3433878..3434345 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
| QEN30_RS17145 (3434523) | 3434523..3434810 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| QEN30_RS17150 (3434798) | 3434798..3435283 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
| QEN30_RS17155 (3435655) | 3435655..3436194 | - | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
| QEN30_RS17160 (3436368) | 3436368..3436580 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| QEN30_RS17165 (3436869) | 3436869..3437159 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| QEN30_RS17170 (3437598) | 3437598..3438308 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| QEN30_RS17175 (3438358) | 3438358..3439332 | - | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| QEN30_RS17180 (3439551) | 3439551..3440213 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T278890 WP_000533909.1 NZ_CP123280:3434798-3435283 [Salmonella sp. SA17155]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7F36 | |
| PDB | 7AK8 | |
| PDB | 5FVJ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |