Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 2406241..2406817 | Replicon | chromosome |
| Accession | NZ_CP123280 | ||
| Organism | Salmonella sp. SA17155 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | QEN30_RS12285 | Protein ID | WP_001131963.1 |
| Coordinates | 2406530..2406817 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | QEN30_RS12280 | Protein ID | WP_000063142.1 |
| Coordinates | 2406241..2406543 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN30_RS12265 (2402751) | 2402751..2404901 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
| QEN30_RS12270 (2404996) | 2404996..2405199 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| QEN30_RS12275 (2405210) | 2405210..2406166 | + | 957 | WP_000187839.1 | GTPase | - |
| QEN30_RS12280 (2406241) | 2406241..2406543 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| QEN30_RS12285 (2406530) | 2406530..2406817 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| QEN30_RS12290 (2407086) | 2407086..2408000 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
| QEN30_RS12295 (2408198) | 2408198..2411707 | + | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T278885 WP_001131963.1 NZ_CP123280:c2406817-2406530 [Salmonella sp. SA17155]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |