Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1763716..1764336 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | QEN30_RS09180 | Protein ID | WP_001280991.1 |
Coordinates | 1764118..1764336 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | QEN30_RS09175 | Protein ID | WP_000344807.1 |
Coordinates | 1763716..1764090 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS09165 (1758855) | 1758855..1760048 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QEN30_RS09170 (1760071) | 1760071..1763220 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
QEN30_RS09175 (1763716) | 1763716..1764090 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
QEN30_RS09180 (1764118) | 1764118..1764336 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
QEN30_RS09185 (1764515) | 1764515..1765066 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
QEN30_RS09190 (1765183) | 1765183..1765653 | + | 471 | WP_000136181.1 | YlaC family protein | - |
QEN30_RS09195 (1765709) | 1765709..1765849 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
QEN30_RS09200 (1765855) | 1765855..1766115 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
QEN30_RS09205 (1766340) | 1766340..1767890 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
QEN30_RS09215 (1768121) | 1768121..1768510 | + | 390 | WP_000961285.1 | MGMT family protein | - |
QEN30_RS09220 (1768543) | 1768543..1769112 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T278882 WP_001280991.1 NZ_CP123280:1764118-1764336 [Salmonella sp. SA17155]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT278882 WP_000344807.1 NZ_CP123280:1763716-1764090 [Salmonella sp. SA17155]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|