Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 714297..714819 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | QEN30_RS03905 | Protein ID | WP_000221343.1 |
Coordinates | 714535..714819 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | QEN30_RS03900 | Protein ID | WP_000885424.1 |
Coordinates | 714297..714545 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS03875 (709513) | 709513..710979 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
QEN30_RS03880 (711787) | 711787..712501 | + | 715 | Protein_759 | helix-turn-helix domain-containing protein | - |
QEN30_RS03885 (712557) | 712557..713465 | - | 909 | WP_010989018.1 | hypothetical protein | - |
QEN30_RS03890 (713608) | 713608..713940 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
QEN30_RS03895 (713930) | 713930..714145 | - | 216 | WP_000206207.1 | hypothetical protein | - |
QEN30_RS03900 (714297) | 714297..714545 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QEN30_RS03905 (714535) | 714535..714819 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEN30_RS03910 (714990) | 714990..715379 | + | 390 | WP_000194089.1 | RidA family protein | - |
QEN30_RS03915 (715431) | 715431..716510 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
QEN30_RS03920 (716703) | 716703..717191 | - | 489 | WP_280144419.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QEN30_RS03925 (717236) | 717236..718744 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 709516..721601 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T278881 WP_000221343.1 NZ_CP123280:714535-714819 [Salmonella sp. SA17155]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |