Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 116261..116862 Replicon plasmid pYZLc23-1_142k
Accession NZ_CP123268
Organism Escherichia coli strain YZLc23-1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N4686_RS25175 Protein ID WP_001216034.1
Coordinates 116261..116641 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N4686_RS25180 Protein ID WP_001190712.1
Coordinates 116641..116862 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4686_RS25150 (N4686_025150) 111702..113144 - 1443 WP_233336883.1 terminase -
N4686_RS25155 (N4686_025155) 113186..114379 - 1194 WP_032214401.1 hypothetical protein -
N4686_RS25160 (N4686_025160) 114465..114917 - 453 WP_001326849.1 late promoter-activating protein -
N4686_RS25165 (N4686_025165) 115006..116049 - 1044 WP_094318254.1 DUF968 domain-containing protein -
N4686_RS25170 (N4686_025170) 116077..116256 - 180 WP_000113018.1 hypothetical protein -
N4686_RS25175 (N4686_025175) 116261..116641 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4686_RS25180 (N4686_025180) 116641..116862 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4686_RS25185 (N4686_025185) 116935..117324 - 390 WP_000506724.1 S24 family peptidase -
N4686_RS25190 (N4686_025190) 117676..118083 + 408 WP_223656859.1 hypothetical protein -
N4686_RS25195 (N4686_025195) 118084..118440 + 357 WP_001062545.1 hypothetical protein -
N4686_RS25200 (N4686_025200) 119516..119746 - 231 WP_223656858.1 hypothetical protein -
N4686_RS25205 (N4686_025205) 119874..121052 - 1179 WP_233336884.1 hypothetical protein -
N4686_RS25210 (N4686_025210) 121247..121753 - 507 WP_000021754.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / sul1 / qacE / aadA5 / floR / sul2 / aph(4)-Ia / aac(3)-IVa / blaCTX-M-65 / tet(A) - 1..142926 142926


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T278874 WP_001216034.1 NZ_CP123268:c116641-116261 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT278874 WP_001190712.1 NZ_CP123268:c116862-116641 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References