Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 104886..105511 | Replicon | plasmid pYZLc23-1_159k |
Accession | NZ_CP123267 | ||
Organism | Escherichia coli strain YZLc23-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4686_RS24215 | Protein ID | WP_000911313.1 |
Coordinates | 105113..105511 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | N4686_RS24210 | Protein ID | WP_000450520.1 |
Coordinates | 104886..105113 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4686_RS24210 (104886) | 104886..105113 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4686_RS24215 (105113) | 105113..105511 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4686_RS24220 (105520) | 105520..107673 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
N4686_RS24225 (107926) | 107926..108657 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
N4686_RS24230 (108689) | 108689..109186 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / fosA3 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..159725 | 159725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T278870 WP_000911313.1 NZ_CP123267:105113-105511 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|