Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 45055..45698 | Replicon | plasmid pYZLc23-1_159k |
Accession | NZ_CP123267 | ||
Organism | Escherichia coli strain YZLc23-1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N4686_RS23875 | Protein ID | WP_001044768.1 |
Coordinates | 45282..45698 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N4686_RS23870 | Protein ID | WP_001261287.1 |
Coordinates | 45055..45285 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4686_RS23855 (41166) | 41166..42254 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
N4686_RS23860 (42256) | 42256..43125 | + | 870 | WP_000253407.1 | hypothetical protein | - |
N4686_RS23865 (43182) | 43182..44747 | - | 1566 | WP_000741348.1 | AAA family ATPase | - |
N4686_RS23870 (45055) | 45055..45285 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N4686_RS23875 (45282) | 45282..45698 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4686_RS23880 (45860) | 45860..47998 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
N4686_RS23885 (48352) | 48352..48609 | + | 258 | WP_000343085.1 | hypothetical protein | - |
N4686_RS23890 (48609) | 48609..49199 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / fosA3 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..159725 | 159725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278865 WP_001044768.1 NZ_CP123267:45282-45698 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |