Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4205214..4206049 Replicon chromosome
Accession NZ_CP123266
Organism Escherichia coli strain YZLc23-1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1M0VTI9
Locus tag N4686_RS20370 Protein ID WP_072649755.1
Coordinates 4205214..4205591 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag N4686_RS20375 Protein ID WP_001285607.1
Coordinates 4205681..4206049 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4686_RS20335 (4200569) 4200569..4201549 + 981 WP_001366032.1 sialate O-acetylesterase -
N4686_RS20340 (4201557) 4201557..4201661 - 105 Protein_3980 HNH endonuclease -
N4686_RS20345 (4201761) 4201761..4202633 + 873 WP_000168567.1 HNH endonuclease -
N4686_RS20350 (4202744) 4202744..4203742 - 999 WP_001240355.1 membrane protein -
N4686_RS20355 (4204284) 4204284..4204427 - 144 Protein_3983 hypothetical protein -
N4686_RS20360 (4204512) 4204512..4204709 - 198 WP_001327226.1 DUF957 domain-containing protein -
N4686_RS20365 (4204729) 4204729..4205217 - 489 WP_000761685.1 DUF5983 family protein -
N4686_RS20370 (4205214) 4205214..4205591 - 378 WP_072649755.1 TA system toxin CbtA family protein Toxin
N4686_RS20375 (4205681) 4205681..4206049 - 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4686_RS20380 (4206129) 4206129..4206350 - 222 WP_000692350.1 DUF987 domain-containing protein -
N4686_RS20385 (4206437) 4206437..4206913 - 477 WP_001384029.1 RadC family protein -
N4686_RS20390 (4206928) 4206928..4207413 - 486 WP_000213722.1 antirestriction protein -
N4686_RS20395 (4207505) 4207505..4208323 - 819 WP_001175175.1 DUF932 domain-containing protein -
N4686_RS20400 (4208413) 4208413..4208622 - 210 WP_032150870.1 DUF905 family protein -
N4686_RS20405 (4208652) 4208652..4209329 - 678 WP_001097301.1 hypothetical protein -
N4686_RS20410 (4209477) 4209477..4210157 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB 4196605..4224737 28132


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14216.18 Da        Isoelectric Point: 7.3523

>T278861 WP_072649755.1 NZ_CP123266:c4205591-4205214 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SVCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPWAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT278861 WP_001285607.1 NZ_CP123266:c4206049-4205681 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M0VTI9

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References