Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3638141..3638978 | Replicon | chromosome |
Accession | NZ_CP123266 | ||
Organism | Escherichia coli strain YZLc23-1 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | N4686_RS17750 | Protein ID | WP_000227784.1 |
Coordinates | 3638436..3638978 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N4686_RS17745 | Protein ID | WP_001297137.1 |
Coordinates | 3638141..3638452 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4686_RS17720 (3633161) | 3633161..3634108 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
N4686_RS17725 (3634130) | 3634130..3636121 | + | 1992 | WP_134233412.1 | cytochrome o ubiquinol oxidase subunit I | - |
N4686_RS17730 (3636111) | 3636111..3636725 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N4686_RS17735 (3636725) | 3636725..3637054 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N4686_RS17740 (3637066) | 3637066..3637956 | + | 891 | WP_000971336.1 | heme o synthase | - |
N4686_RS17745 (3638141) | 3638141..3638452 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N4686_RS17750 (3638436) | 3638436..3638978 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
N4686_RS17755 (3639034) | 3639034..3639969 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
N4686_RS17760 (3640377) | 3640377..3641741 | + | 1365 | WP_023143167.1 | MFS transporter | - |
N4686_RS17765 (3641869) | 3641869..3642360 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N4686_RS17770 (3642528) | 3642528..3643439 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T278859 WP_000227784.1 NZ_CP123266:3638436-3638978 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|