Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1336131..1336756 | Replicon | chromosome |
Accession | NZ_CP123266 | ||
Organism | Escherichia coli strain YZLc23-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | N4686_RS06520 | Protein ID | WP_000911329.1 |
Coordinates | 1336358..1336756 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N4686_RS06515 | Protein ID | WP_000450524.1 |
Coordinates | 1336131..1336358 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4686_RS06490 (1331933) | 1331933..1332403 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
N4686_RS06495 (1332403) | 1332403..1332975 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N4686_RS06500 (1333121) | 1333121..1333999 | + | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N4686_RS06505 (1334016) | 1334016..1335050 | + | 1035 | WP_023142816.1 | outer membrane protein assembly factor BamC | - |
N4686_RS06510 (1335263) | 1335263..1335976 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N4686_RS06515 (1336131) | 1336131..1336358 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4686_RS06520 (1336358) | 1336358..1336756 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4686_RS06525 (1336903) | 1336903..1337766 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
N4686_RS06530 (1337781) | 1337781..1339796 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N4686_RS06535 (1339870) | 1339870..1340568 | + | 699 | WP_000679823.1 | esterase | - |
N4686_RS06540 (1340678) | 1340678..1340878 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T278850 WP_000911329.1 NZ_CP123266:1336358-1336756 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |