Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 12922..13565 | Replicon | plasmid pYZLc4-1_94k |
Accession | NZ_CP123263 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A1L4J633 |
Locus tag | N4697_RS25155 | Protein ID | WP_047612429.1 |
Coordinates | 12922..13338 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A627FA37 |
Locus tag | N4697_RS25160 | Protein ID | WP_001604445.1 |
Coordinates | 13335..13565 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS25140 (N4697_025145) | 8600..9595 | - | 996 | WP_000246636.1 | hypothetical protein | - |
N4697_RS25145 (N4697_025150) | 10024..11595 | + | 1572 | WP_047613524.1 | ATP-binding protein | - |
N4697_RS25150 (N4697_025155) | 11802..12782 | - | 981 | WP_089576189.1 | hypothetical protein | - |
N4697_RS25155 (N4697_025160) | 12922..13338 | - | 417 | WP_047612429.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4697_RS25160 (N4697_025165) | 13335..13565 | - | 231 | WP_001604445.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N4697_RS25165 (N4697_025170) | 13522..13712 | + | 191 | Protein_15 | hypothetical protein | - |
N4697_RS25170 (N4697_025175) | 13918..14919 | + | 1002 | WP_000785695.1 | DUF4238 domain-containing protein | - |
N4697_RS25175 (N4697_025180) | 15093..15437 | - | 345 | WP_000792769.1 | hypothetical protein | - |
N4697_RS25180 (N4697_025185) | 15935..16189 | - | 255 | WP_000678528.1 | hypothetical protein | - |
N4697_RS25185 (N4697_025190) | 16239..17165 | - | 927 | WP_001290414.1 | hypothetical protein | - |
N4697_RS25190 (N4697_025195) | 17698..18012 | + | 315 | WP_001302628.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..94872 | 94872 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15064.41 Da Isoelectric Point: 6.7125
>T278843 WP_047612429.1 NZ_CP123263:c13338-12922 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L4J633 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A627FA37 |