Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 132783..133426 Replicon plasmid pYZLc4-1_138k
Accession NZ_CP123262
Organism Escherichia coli strain YZLc4-1

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag N4697_RS25055 Protein ID WP_001034044.1
Coordinates 133010..133426 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag N4697_RS25050 Protein ID WP_001261286.1
Coordinates 132783..133013 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4697_RS25035 (127920) 127920..128150 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
N4697_RS25040 (128147) 128147..128563 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
N4697_RS25045 (128608) 128608..132402 - 3795 WP_221686811.1 pcar -
N4697_RS25050 (132783) 132783..133013 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N4697_RS25055 (133010) 133010..133426 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
N4697_RS25060 (133501) 133501..135066 + 1566 WP_001128474.1 AAA family ATPase -
N4697_RS25065 (135051) 135051..136073 + 1023 WP_000361402.1 helicase UvrD -
N4697_RS25075 (137079) 137079..137499 - 421 Protein_161 protein ImpB -
N4697_RS25080 (137560) 137560..137664 - 105 Protein_162 AAA family ATPase -
N4697_RS25085 (137666) 137666..137989 - 324 Protein_163 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / sul2 faeI / faeH / faeF / faeE / faeD / faeC 1..138734 138734


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T278842 WP_001034044.1 NZ_CP123262:133010-133426 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT278842 WP_001261286.1 NZ_CP123262:132783-133013 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References