Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 132783..133426 | Replicon | plasmid pYZLc4-1_138k |
| Accession | NZ_CP123262 | ||
| Organism | Escherichia coli strain YZLc4-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | N4697_RS25055 | Protein ID | WP_001034044.1 |
| Coordinates | 133010..133426 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | N4697_RS25050 | Protein ID | WP_001261286.1 |
| Coordinates | 132783..133013 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4697_RS25035 (127920) | 127920..128150 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| N4697_RS25040 (128147) | 128147..128563 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| N4697_RS25045 (128608) | 128608..132402 | - | 3795 | WP_221686811.1 | pcar | - |
| N4697_RS25050 (132783) | 132783..133013 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N4697_RS25055 (133010) | 133010..133426 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N4697_RS25060 (133501) | 133501..135066 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| N4697_RS25065 (135051) | 135051..136073 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| N4697_RS25075 (137079) | 137079..137499 | - | 421 | Protein_161 | protein ImpB | - |
| N4697_RS25080 (137560) | 137560..137664 | - | 105 | Protein_162 | AAA family ATPase | - |
| N4697_RS25085 (137666) | 137666..137989 | - | 324 | Protein_163 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / sul2 | faeI / faeH / faeF / faeE / faeD / faeC | 1..138734 | 138734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T278842 WP_001034044.1 NZ_CP123262:133010-133426 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |