Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 123430..123955 | Replicon | plasmid pYZLc4-1_138k |
Accession | NZ_CP123262 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | N4697_RS25005 | Protein ID | WP_001159868.1 |
Coordinates | 123430..123735 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | N4697_RS25010 | Protein ID | WP_000813634.1 |
Coordinates | 123737..123955 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS24990 (119392) | 119392..120558 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
N4697_RS24995 (121146) | 121146..121901 | - | 756 | WP_221686810.1 | replication initiation protein RepE | - |
N4697_RS25000 (122623) | 122623..123429 | - | 807 | WP_053285710.1 | site-specific integrase | - |
N4697_RS25005 (123430) | 123430..123735 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
N4697_RS25010 (123737) | 123737..123955 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
N4697_RS25015 (124547) | 124547..125035 | + | 489 | WP_011254646.1 | hypothetical protein | - |
N4697_RS25020 (125069) | 125069..126202 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
N4697_RS25025 (126369) | 126369..127142 | - | 774 | WP_000905949.1 | hypothetical protein | - |
N4697_RS25030 (127155) | 127155..127655 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
N4697_RS25035 (127920) | 127920..128150 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
N4697_RS25040 (128147) | 128147..128563 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / sul2 | faeI / faeH / faeF / faeE / faeD / faeC | 1..138734 | 138734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278840 WP_001159868.1 NZ_CP123262:c123735-123430 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|