Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 23225..23868 Replicon plasmid pYZLc4-1_138k
Accession NZ_CP123262
Organism Escherichia coli strain YZLc4-1

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag N4697_RS24415 Protein ID WP_001044768.1
Coordinates 23452..23868 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag N4697_RS24410 Protein ID WP_001261287.1
Coordinates 23225..23455 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4697_RS24380 (19221) 19221..19970 + 750 WP_106141716.1 EAL domain-containing protein -
N4697_RS24385 (20015) 20015..20689 - 675 WP_232379284.1 helix-turn-helix domain-containing protein -
N4697_RS24390 (21130) 21130..22014 + 885 WP_000942222.1 helix-turn-helix domain-containing protein -
N4697_RS24395 (22151) 22151..22297 - 147 WP_162822579.1 hypothetical protein -
N4697_RS24400 (22297) 22297..22538 - 242 Protein_26 hypothetical protein -
N4697_RS24405 (22598) 22598..23040 + 443 Protein_27 transposase -
N4697_RS24410 (23225) 23225..23455 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N4697_RS24415 (23452) 23452..23868 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
N4697_RS24420 (24221) 24221..24307 - 87 Protein_30 IS66 family insertion sequence element accessory protein TnpB -
N4697_RS24425 (24307) 24307..24954 - 648 WP_180391910.1 IS66-like element accessory protein TnpA -
N4697_RS24430 (25027) 25027..25188 + 162 WP_001384894.1 hypothetical protein -
N4697_RS24435 (25560) 25560..26417 - 858 WP_202374666.1 (S)-acetoin forming diacetyl reductase -
N4697_RS24440 (26519) 26519..26737 + 219 WP_001292878.1 hypothetical protein -
N4697_RS24445 (26780) 26780..27877 + 1098 WP_221686783.1 choloylglycine hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / sul2 faeI / faeH / faeF / faeE / faeD / faeC 1..138734 138734
- inside IScluster/Tn - - 22598..24954 2356


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T278839 WP_001044768.1 NZ_CP123262:23452-23868 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT278839 WP_001261287.1 NZ_CP123262:23225-23455 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References