Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 23225..23868 | Replicon | plasmid pYZLc4-1_138k |
| Accession | NZ_CP123262 | ||
| Organism | Escherichia coli strain YZLc4-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | N4697_RS24415 | Protein ID | WP_001044768.1 |
| Coordinates | 23452..23868 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | N4697_RS24410 | Protein ID | WP_001261287.1 |
| Coordinates | 23225..23455 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4697_RS24380 (19221) | 19221..19970 | + | 750 | WP_106141716.1 | EAL domain-containing protein | - |
| N4697_RS24385 (20015) | 20015..20689 | - | 675 | WP_232379284.1 | helix-turn-helix domain-containing protein | - |
| N4697_RS24390 (21130) | 21130..22014 | + | 885 | WP_000942222.1 | helix-turn-helix domain-containing protein | - |
| N4697_RS24395 (22151) | 22151..22297 | - | 147 | WP_162822579.1 | hypothetical protein | - |
| N4697_RS24400 (22297) | 22297..22538 | - | 242 | Protein_26 | hypothetical protein | - |
| N4697_RS24405 (22598) | 22598..23040 | + | 443 | Protein_27 | transposase | - |
| N4697_RS24410 (23225) | 23225..23455 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N4697_RS24415 (23452) | 23452..23868 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N4697_RS24420 (24221) | 24221..24307 | - | 87 | Protein_30 | IS66 family insertion sequence element accessory protein TnpB | - |
| N4697_RS24425 (24307) | 24307..24954 | - | 648 | WP_180391910.1 | IS66-like element accessory protein TnpA | - |
| N4697_RS24430 (25027) | 25027..25188 | + | 162 | WP_001384894.1 | hypothetical protein | - |
| N4697_RS24435 (25560) | 25560..26417 | - | 858 | WP_202374666.1 | (S)-acetoin forming diacetyl reductase | - |
| N4697_RS24440 (26519) | 26519..26737 | + | 219 | WP_001292878.1 | hypothetical protein | - |
| N4697_RS24445 (26780) | 26780..27877 | + | 1098 | WP_221686783.1 | choloylglycine hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / sul2 | faeI / faeH / faeF / faeE / faeD / faeC | 1..138734 | 138734 | |
| - | inside | IScluster/Tn | - | - | 22598..24954 | 2356 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278839 WP_001044768.1 NZ_CP123262:23452-23868 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |