Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 116966..117567 Replicon plasmid pYZLc4-1_143k
Accession NZ_CP123261
Organism Escherichia coli strain YZLc4-1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N4697_RS24090 Protein ID WP_001216034.1
Coordinates 116966..117346 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N4697_RS24095 Protein ID WP_001190712.1
Coordinates 117346..117567 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4697_RS24065 (N4697_024070) 112407..113891 - 1485 WP_118940256.1 terminase -
N4697_RS24070 (N4697_024075) 113891..115084 - 1194 WP_032214401.1 hypothetical protein -
N4697_RS24075 (N4697_024080) 115170..115622 - 453 WP_001326849.1 late promoter-activating protein -
N4697_RS24080 (N4697_024085) 115711..116754 - 1044 WP_094318254.1 DUF968 domain-containing protein -
N4697_RS24085 (N4697_024090) 116782..116961 - 180 WP_000113018.1 hypothetical protein -
N4697_RS24090 (N4697_024095) 116966..117346 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4697_RS24095 (N4697_024100) 117346..117567 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4697_RS24100 (N4697_024105) 117640..118029 - 390 WP_000506724.1 S24 family peptidase -
N4697_RS24105 (N4697_024110) 118381..118788 + 408 WP_223656859.1 hypothetical protein -
N4697_RS24110 (N4697_024115) 118789..119145 + 357 WP_001062545.1 hypothetical protein -
N4697_RS24115 (N4697_024120) 120221..120451 - 231 WP_223656858.1 hypothetical protein -
N4697_RS24120 (N4697_024125) 120579..121757 - 1179 WP_233336884.1 hypothetical protein -
N4697_RS24125 (N4697_024130) 121952..122458 - 507 WP_000021754.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / blaTEM-1B / floR / sul2 / aph(4)-Ia / aac(3)-IVa / blaCTX-M-65 / tet(A) - 1..143631 143631


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T278838 WP_001216034.1 NZ_CP123261:c117346-116966 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT278838 WP_001190712.1 NZ_CP123261:c117567-117346 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References