Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 116966..117567 | Replicon | plasmid pYZLc4-1_143k |
| Accession | NZ_CP123261 | ||
| Organism | Escherichia coli strain YZLc4-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | N4697_RS24090 | Protein ID | WP_001216034.1 |
| Coordinates | 116966..117346 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N4697_RS24095 | Protein ID | WP_001190712.1 |
| Coordinates | 117346..117567 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4697_RS24065 (N4697_024070) | 112407..113891 | - | 1485 | WP_118940256.1 | terminase | - |
| N4697_RS24070 (N4697_024075) | 113891..115084 | - | 1194 | WP_032214401.1 | hypothetical protein | - |
| N4697_RS24075 (N4697_024080) | 115170..115622 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| N4697_RS24080 (N4697_024085) | 115711..116754 | - | 1044 | WP_094318254.1 | DUF968 domain-containing protein | - |
| N4697_RS24085 (N4697_024090) | 116782..116961 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| N4697_RS24090 (N4697_024095) | 116966..117346 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N4697_RS24095 (N4697_024100) | 117346..117567 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N4697_RS24100 (N4697_024105) | 117640..118029 | - | 390 | WP_000506724.1 | S24 family peptidase | - |
| N4697_RS24105 (N4697_024110) | 118381..118788 | + | 408 | WP_223656859.1 | hypothetical protein | - |
| N4697_RS24110 (N4697_024115) | 118789..119145 | + | 357 | WP_001062545.1 | hypothetical protein | - |
| N4697_RS24115 (N4697_024120) | 120221..120451 | - | 231 | WP_223656858.1 | hypothetical protein | - |
| N4697_RS24120 (N4697_024125) | 120579..121757 | - | 1179 | WP_233336884.1 | hypothetical protein | - |
| N4697_RS24125 (N4697_024130) | 121952..122458 | - | 507 | WP_000021754.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / blaTEM-1B / floR / sul2 / aph(4)-Ia / aac(3)-IVa / blaCTX-M-65 / tet(A) | - | 1..143631 | 143631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T278838 WP_001216034.1 NZ_CP123261:c117346-116966 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |