Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4284420..4284942 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N4697_RS20710 | Protein ID | WP_104773392.1 |
Coordinates | 4284420..4284710 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | N4697_RS20715 | Protein ID | WP_000212715.1 |
Coordinates | 4284700..4284942 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS20695 (4279588) | 4279588..4281243 | + | 1656 | WP_063625319.1 | alpha,alpha-phosphotrehalase | - |
N4697_RS20700 (4281637) | 4281637..4283775 | + | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4697_RS20705 (4283955) | 4283955..4284419 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4697_RS20710 (4284420) | 4284420..4284710 | - | 291 | WP_104773392.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4697_RS20715 (4284700) | 4284700..4284942 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4697_RS20720 (4285134) | 4285134..4285520 | - | 387 | WP_001232253.1 | cytochrome b562 | - |
N4697_RS20725 (4285576) | 4285576..4286928 | - | 1353 | WP_063625320.1 | metalloprotease PmbA | - |
N4697_RS20730 (4287022) | 4287022..4287573 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
N4697_RS20735 (4287656) | 4287656..4289029 | - | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T278834 WP_104773392.1 NZ_CP123260:c4284710-4284420 [Escherichia coli]
MNYELAFDPRALKEWQKLGVAVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVITIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVAVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVITIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|