Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3648548..3649385 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | N4697_RS17855 | Protein ID | WP_000227784.1 |
Coordinates | 3648843..3649385 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N4697_RS17850 | Protein ID | WP_001297137.1 |
Coordinates | 3648548..3648859 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS17825 (3643568) | 3643568..3644515 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
N4697_RS17830 (3644537) | 3644537..3646528 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
N4697_RS17835 (3646518) | 3646518..3647132 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N4697_RS17840 (3647132) | 3647132..3647461 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N4697_RS17845 (3647473) | 3647473..3648363 | + | 891 | WP_000971336.1 | heme o synthase | - |
N4697_RS17850 (3648548) | 3648548..3648859 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N4697_RS17855 (3648843) | 3648843..3649385 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
N4697_RS17860 (3649441) | 3649441..3650376 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
N4697_RS17865 (3650784) | 3650784..3652148 | + | 1365 | WP_001000974.1 | MFS transporter | - |
N4697_RS17870 (3652276) | 3652276..3652767 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N4697_RS17875 (3652935) | 3652935..3653846 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T278832 WP_000227784.1 NZ_CP123260:3648843-3649385 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|