Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3614468..3615086 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N4697_RS17685 | Protein ID | WP_001291435.1 |
Coordinates | 3614868..3615086 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N4697_RS17680 | Protein ID | WP_000344800.1 |
Coordinates | 3614468..3614842 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS17670 (3609557) | 3609557..3610750 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4697_RS17675 (3610773) | 3610773..3613922 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N4697_RS17680 (3614468) | 3614468..3614842 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N4697_RS17685 (3614868) | 3614868..3615086 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N4697_RS17690 (3615258) | 3615258..3615809 | + | 552 | WP_262934964.1 | maltose O-acetyltransferase | - |
N4697_RS17695 (3615925) | 3615925..3616395 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N4697_RS17700 (3616559) | 3616559..3618109 | + | 1551 | WP_063625273.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N4697_RS17705 (3618151) | 3618151..3618504 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N4697_RS17715 (3618883) | 3618883..3619194 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N4697_RS17720 (3619225) | 3619225..3619797 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278831 WP_001291435.1 NZ_CP123260:3614868-3615086 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278831 WP_000344800.1 NZ_CP123260:3614468-3614842 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |