Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2498040..2498678 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N4697_RS12165 | Protein ID | WP_000813794.1 |
Coordinates | 2498502..2498678 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4697_RS12160 | Protein ID | WP_001270286.1 |
Coordinates | 2498040..2498456 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS12140 (2493192) | 2493192..2494133 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
N4697_RS12145 (2494134) | 2494134..2495147 | - | 1014 | WP_063625587.1 | ABC transporter ATP-binding protein | - |
N4697_RS12150 (2495165) | 2495165..2496310 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
N4697_RS12155 (2496555) | 2496555..2497961 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
N4697_RS12160 (2498040) | 2498040..2498456 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N4697_RS12165 (2498502) | 2498502..2498678 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N4697_RS12170 (2498900) | 2498900..2499130 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N4697_RS12175 (2499222) | 2499222..2501183 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N4697_RS12180 (2501256) | 2501256..2501792 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N4697_RS12185 (2501884) | 2501884..2503059 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2503099..2504247 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278830 WP_000813794.1 NZ_CP123260:c2498678-2498502 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278830 WP_001270286.1 NZ_CP123260:c2498456-2498040 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|