Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1354273..1354898 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4697_RS06620 | Protein ID | WP_000911330.1 |
Coordinates | 1354500..1354898 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N4697_RS06615 | Protein ID | WP_000450524.1 |
Coordinates | 1354273..1354500 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS06590 (1350076) | 1350076..1350546 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
N4697_RS06595 (1350546) | 1350546..1351118 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N4697_RS06600 (1351264) | 1351264..1352142 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N4697_RS06605 (1352159) | 1352159..1353193 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N4697_RS06610 (1353406) | 1353406..1354119 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N4697_RS06615 (1354273) | 1354273..1354500 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4697_RS06620 (1354500) | 1354500..1354898 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4697_RS06625 (1355045) | 1355045..1355908 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
N4697_RS06630 (1355923) | 1355923..1357938 | + | 2016 | WP_000829335.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N4697_RS06635 (1358012) | 1358012..1358710 | + | 699 | WP_000679812.1 | esterase | - |
N4697_RS06640 (1358820) | 1358820..1359020 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278824 WP_000911330.1 NZ_CP123260:1354500-1354898 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|