Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 915491..916145 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | N4697_RS04485 | Protein ID | WP_000244772.1 |
Coordinates | 915738..916145 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N4697_RS04480 | Protein ID | WP_000354046.1 |
Coordinates | 915491..915757 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS04455 (910779) | 910779..911522 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
N4697_RS04460 (911579) | 911579..913012 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
N4697_RS04465 (913057) | 913057..913368 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
N4697_RS04470 (913532) | 913532..914191 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N4697_RS04475 (914268) | 914268..915248 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
N4697_RS04480 (915491) | 915491..915757 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N4697_RS04485 (915738) | 915738..916145 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
N4697_RS04490 (916185) | 916185..916706 | - | 522 | WP_063625410.1 | flavodoxin FldB | - |
N4697_RS04495 (916818) | 916818..917714 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N4697_RS04500 (917739) | 917739..918449 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N4697_RS04505 (918455) | 918455..920188 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T278821 WP_000244772.1 NZ_CP123260:915738-916145 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |