Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 331602..332402 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | N4697_RS01540 | Protein ID | WP_000342451.1 |
Coordinates | 331875..332402 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | N4697_RS01535 | Protein ID | WP_001277108.1 |
Coordinates | 331602..331868 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS01515 (327260) | 327260..327928 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
N4697_RS01520 (327921) | 327921..328979 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
N4697_RS01525 (329223) | 329223..330077 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
N4697_RS01530 (330349) | 330349..331452 | + | 1104 | WP_078167906.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
N4697_RS01535 (331602) | 331602..331868 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
N4697_RS01540 (331875) | 331875..332402 | + | 528 | WP_000342451.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
N4697_RS01545 (332399) | 332399..332782 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
N4697_RS01550 (333206) | 333206..334315 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
N4697_RS01555 (334363) | 334363..335289 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
N4697_RS01560 (335286) | 335286..336563 | + | 1278 | WP_000803798.1 | branched chain amino acid ABC transporter permease LivM | - |
N4697_RS01565 (336560) | 336560..337327 | + | 768 | WP_000082110.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19749.73 Da Isoelectric Point: 7.3232
>T278819 WP_000342451.1 NZ_CP123260:331875-332402 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|