Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49352..50150 | Replicon | chromosome |
| Accession | NZ_CP123260 | ||
| Organism | Escherichia coli strain YZLc4-1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N4697_RS00255 | Protein ID | WP_000854735.1 |
| Coordinates | 49352..49729 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | N4697_RS00260 | Protein ID | WP_001285415.1 |
| Coordinates | 49776..50150 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4697_RS00225 (44699) | 44699..45622 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| N4697_RS00230 (45733) | 45733..46887 | - | 1155 | WP_063625243.1 | sugar efflux transporter | - |
| N4697_RS00235 (47348) | 47348..47476 | - | 129 | Protein_46 | RhuM family protein | - |
| N4697_RS00240 (47713) | 47713..48555 | - | 843 | WP_000036706.1 | DUF4942 domain-containing protein | - |
| N4697_RS00245 (48652) | 48652..48849 | - | 198 | WP_000839266.1 | DUF957 domain-containing protein | - |
| N4697_RS00250 (48867) | 48867..49355 | - | 489 | WP_000761680.1 | DUF5983 family protein | - |
| N4697_RS00255 (49352) | 49352..49729 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N4697_RS00260 (49776) | 49776..50150 | - | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N4697_RS00265 (50230) | 50230..50451 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| N4697_RS00270 (50514) | 50514..50990 | - | 477 | WP_001186774.1 | RadC family protein | - |
| N4697_RS00275 (51006) | 51006..51491 | - | 486 | WP_262934967.1 | antirestriction protein | - |
| N4697_RS00280 (51583) | 51583..52401 | - | 819 | WP_165473672.1 | DUF932 domain-containing protein | - |
| N4697_RS00285 (52491) | 52491..52724 | - | 234 | WP_001278288.1 | DUF905 family protein | - |
| N4697_RS00290 (52730) | 52730..53407 | - | 678 | WP_001097362.1 | hypothetical protein | - |
| N4697_RS00295 (53526) | 53526..54410 | - | 885 | WP_000010399.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T278818 WP_000854735.1 NZ_CP123260:c49729-49352 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT278818 WP_001285415.1 NZ_CP123260:c50150-49776 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |