Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 55263..55864 Replicon plasmid pYZMc17-1_100k
Accession NZ_CP123256
Organism Escherichia coli strain YZMc17-1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N4680_RS23725 Protein ID WP_105075168.1
Coordinates 55263..55643 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N4680_RS23730 Protein ID WP_001190712.1
Coordinates 55643..55864 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4680_RS23695 (N4680_23700) 50389..50619 - 231 Protein_54 ash family protein -
N4680_RS23700 (N4680_23705) 50703..52145 - 1443 WP_228253691.1 terminase -
N4680_RS23705 (N4680_23710) 52187..53380 - 1194 WP_105075170.1 terminase -
N4680_RS23710 (N4680_23715) 53467..53919 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
N4680_RS23715 (N4680_23720) 54008..55051 - 1044 WP_105075169.1 DUF968 domain-containing protein -
N4680_RS23720 (N4680_23725) 55079..55258 - 180 WP_000113019.1 hypothetical protein -
N4680_RS23725 (N4680_23730) 55263..55643 - 381 WP_105075168.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4680_RS23730 (N4680_23735) 55643..55864 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4680_RS23735 (N4680_23740) 55937..56326 - 390 WP_000506726.1 S24 family peptidase -
N4680_RS23740 (N4680_23745) 56450..56701 - 252 WP_001377386.1 DNA polymerase III subunit theta -
N4680_RS23745 (N4680_23750) 57151..57288 + 138 WP_000123562.1 hypothetical protein -
N4680_RS23750 (N4680_23755) 57363..57725 - 363 WP_001261544.1 hypothetical protein -
N4680_RS23755 (N4680_23760) 57722..58654 - 933 WP_000057449.1 hypothetical protein -
N4680_RS23760 (N4680_23765) 58636..59010 - 375 WP_000988658.1 hypothetical protein -
N4680_RS23765 (N4680_23770) 59017..59310 - 294 WP_050153512.1 hypothetical protein -
N4680_RS23770 (N4680_23775) 59489..59722 - 234 WP_000516537.1 hypothetical protein -
N4680_RS23775 (N4680_23780) 59805..60218 - 414 Protein_70 DUF551 domain-containing protein -
N4680_RS23780 (N4680_23785) 60390..60569 - 180 Protein_71 hypothetical protein -
N4680_RS23785 (N4680_23790) 60585..60713 - 129 Protein_72 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..100394 100394


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13612.28 Da        Isoelectric Point: 5.5803

>T278814 WP_105075168.1 NZ_CP123256:c55643-55263 [Escherichia coli]
MRHISPEEHIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT278814 WP_001190712.1 NZ_CP123256:c55864-55643 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References