Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 55263..55864 | Replicon | plasmid pYZMc17-1_100k |
| Accession | NZ_CP123256 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | N4680_RS23725 | Protein ID | WP_105075168.1 |
| Coordinates | 55263..55643 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N4680_RS23730 | Protein ID | WP_001190712.1 |
| Coordinates | 55643..55864 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS23695 (N4680_23700) | 50389..50619 | - | 231 | Protein_54 | ash family protein | - |
| N4680_RS23700 (N4680_23705) | 50703..52145 | - | 1443 | WP_228253691.1 | terminase | - |
| N4680_RS23705 (N4680_23710) | 52187..53380 | - | 1194 | WP_105075170.1 | terminase | - |
| N4680_RS23710 (N4680_23715) | 53467..53919 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| N4680_RS23715 (N4680_23720) | 54008..55051 | - | 1044 | WP_105075169.1 | DUF968 domain-containing protein | - |
| N4680_RS23720 (N4680_23725) | 55079..55258 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| N4680_RS23725 (N4680_23730) | 55263..55643 | - | 381 | WP_105075168.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N4680_RS23730 (N4680_23735) | 55643..55864 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N4680_RS23735 (N4680_23740) | 55937..56326 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
| N4680_RS23740 (N4680_23745) | 56450..56701 | - | 252 | WP_001377386.1 | DNA polymerase III subunit theta | - |
| N4680_RS23745 (N4680_23750) | 57151..57288 | + | 138 | WP_000123562.1 | hypothetical protein | - |
| N4680_RS23750 (N4680_23755) | 57363..57725 | - | 363 | WP_001261544.1 | hypothetical protein | - |
| N4680_RS23755 (N4680_23760) | 57722..58654 | - | 933 | WP_000057449.1 | hypothetical protein | - |
| N4680_RS23760 (N4680_23765) | 58636..59010 | - | 375 | WP_000988658.1 | hypothetical protein | - |
| N4680_RS23765 (N4680_23770) | 59017..59310 | - | 294 | WP_050153512.1 | hypothetical protein | - |
| N4680_RS23770 (N4680_23775) | 59489..59722 | - | 234 | WP_000516537.1 | hypothetical protein | - |
| N4680_RS23775 (N4680_23780) | 59805..60218 | - | 414 | Protein_70 | DUF551 domain-containing protein | - |
| N4680_RS23780 (N4680_23785) | 60390..60569 | - | 180 | Protein_71 | hypothetical protein | - |
| N4680_RS23785 (N4680_23790) | 60585..60713 | - | 129 | Protein_72 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..100394 | 100394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13612.28 Da Isoelectric Point: 5.5803
>T278814 WP_105075168.1 NZ_CP123256:c55643-55263 [Escherichia coli]
MRHISPEEHIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEEHIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|