Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2500907..2501545 | Replicon | chromosome |
Accession | NZ_CP123255 | ||
Organism | Escherichia coli strain YZMc17-1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | N4680_RS12080 | Protein ID | WP_001447010.1 |
Coordinates | 2501369..2501545 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4680_RS12075 | Protein ID | WP_001270286.1 |
Coordinates | 2500907..2501323 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4680_RS12055 (2496059) | 2496059..2497000 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
N4680_RS12060 (2497001) | 2497001..2498014 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N4680_RS12065 (2498032) | 2498032..2499177 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N4680_RS12070 (2499422) | 2499422..2500828 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N4680_RS12075 (2500907) | 2500907..2501323 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N4680_RS12080 (2501369) | 2501369..2501545 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N4680_RS12085 (2501767) | 2501767..2501997 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N4680_RS12090 (2502089) | 2502089..2504050 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N4680_RS12095 (2504123) | 2504123..2504659 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N4680_RS12100 (2504751) | 2504751..2505926 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T278807 WP_001447010.1 NZ_CP123255:c2501545-2501369 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278807 WP_001270286.1 NZ_CP123255:c2501323-2500907 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|