Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 886872..887526 | Replicon | chromosome |
| Accession | NZ_CP123255 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N4680_RS04400 | Protein ID | WP_000244781.1 |
| Coordinates | 887119..887526 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N4680_RS04395 | Protein ID | WP_000354046.1 |
| Coordinates | 886872..887138 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS04375 (882960) | 882960..884393 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
| N4680_RS04380 (884438) | 884438..884749 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
| N4680_RS04385 (884913) | 884913..885572 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| N4680_RS04390 (885649) | 885649..886629 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| N4680_RS04395 (886872) | 886872..887138 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N4680_RS04400 (887119) | 887119..887526 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N4680_RS04405 (887566) | 887566..888087 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
| N4680_RS04410 (888199) | 888199..889095 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N4680_RS04415 (889120) | 889120..889830 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N4680_RS04420 (889836) | 889836..891569 | + | 1734 | WP_021523238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T278798 WP_000244781.1 NZ_CP123255:887119-887526 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|