Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 104162..104672 Replicon plasmid pYZLc5-3_NDM-1_129k
Accession NZ_CP123252
Organism Providencia rettgeri strain YZLc5-3

Toxin (Protein)


Gene name relB Uniprot ID -
Locus tag N4838_RS21390 Protein ID WP_019281448.1
Coordinates 104162..104425 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A7X5B7D9
Locus tag N4838_RS21395 Protein ID WP_009836585.1
Coordinates 104418..104672 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4838_RS21360 (N4838_021435) 99183..99932 + 750 WP_071547986.1 signal peptidase I -
N4838_RS21365 (N4838_021440) 100012..100269 + 258 WP_206091104.1 hypothetical protein -
N4838_RS21375 (N4838_021455) 101825..102235 - 411 WP_206086781.1 IS200/IS605 family transposase -
N4838_RS21380 (N4838_021460) 102290..103495 + 1206 WP_284183216.1 transposase -
N4838_RS21385 (N4838_021465) 103539..103883 + 345 Protein_115 transposase -
N4838_RS21390 (N4838_021470) 104162..104425 - 264 WP_019281448.1 Txe/YoeB family addiction module toxin Toxin
N4838_RS21395 (N4838_021475) 104418..104672 - 255 WP_009836585.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
N4838_RS21400 (N4838_021480) 105033..106007 + 975 WP_223674028.1 IS5-like element IS5 family transposase -
N4838_RS21405 (N4838_021485) 106152..106319 - 168 Protein_119 glycerol dehydratase reactivase beta/small subunit family protein -
N4838_RS21410 (N4838_021490) 106336..107499 - 1164 WP_016243884.1 1,3-propanediol dehydrogenase -
N4838_RS21415 (N4838_021495) 107644..107936 - 293 Protein_121 hypothetical protein -
N4838_RS21420 (N4838_021500) 108033..108353 + 321 WP_206086774.1 IS66 family insertion sequence element accessory protein TnpB -
N4838_RS21425 (N4838_021505) 108563..108724 - 162 Protein_123 transposase -
N4838_RS21430 (N4838_021510) 108753..109085 - 333 WP_125894547.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 / aadA2 / aph(3')-Ia / aac(3)-IVa / aph(4)-Ia / sul2 / floR / aac(6')-Ib-cr / ARR-3 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / tet(B) - 1..129473 129473
- inside IScluster/Tn - - 100971..108622 7651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(6-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10330.69 Da        Isoelectric Point: 8.8578

>T278794 WP_019281448.1 NZ_CP123252:c104425-104162 [Providencia rettgeri]
MSSRLLSWTDESWNDYVYWQTQDKKTLKRINKLITDVKRSPFEGIGKPEPLKENLSGFWSRRIDDANRLVYAVDDSAITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9462.65 Da        Isoelectric Point: 5.5802

>AT278794 WP_009836585.1 NZ_CP123252:c104672-104418 [Providencia rettgeri]
MRIVSFTEARNSLKSVLDAVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPANAEHLHRSIAQFKAGKVSQRD
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7X5B7D9

References