Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 75271..75848 Replicon plasmid pYZLc5-3_NDM-1_129k
Accession NZ_CP123252
Organism Providencia rettgeri strain YZLc5-3

Toxin (Protein)


Gene name mazF Uniprot ID U5N651
Locus tag N4838_RS21260 Protein ID WP_023159957.1
Coordinates 75516..75848 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag N4838_RS21255 Protein ID WP_096864992.1
Coordinates 75271..75516 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4838_RS21220 (N4838_021295) 71024..72070 + 1047 WP_072070749.1 ParB/RepB/Spo0J family partition protein -
N4838_RS21225 (N4838_021300) 72073..72417 + 345 WP_023159966.1 single-stranded DNA-binding protein -
N4838_RS21230 (N4838_021305) 72410..72832 + 423 WP_048821775.1 hypothetical protein -
N4838_RS21235 (N4838_021310) 72842..73351 + 510 WP_282559889.1 hypothetical protein -
N4838_RS21240 (N4838_021315) 73584..73952 + 369 WP_109910890.1 hypothetical protein -
N4838_RS21245 (N4838_021320) 74050..74277 - 228 WP_096864993.1 plasmid partition protein ParG -
N4838_RS21250 (N4838_021325) 74378..75001 - 624 WP_109910889.1 AAA family ATPase -
N4838_RS21255 (N4838_021330) 75271..75516 + 246 WP_096864992.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N4838_RS21260 (N4838_021335) 75516..75848 + 333 WP_023159957.1 endoribonuclease MazF Toxin
N4838_RS21265 (N4838_021340) 75879..76259 + 381 WP_096864991.1 hypothetical protein -
N4838_RS21270 (N4838_021345) 76345..76488 - 144 WP_071547955.1 Hok/Gef family protein -
N4838_RS21275 (N4838_021350) 76853..77302 - 450 WP_165126848.1 hypothetical protein -
N4838_RS21280 (N4838_021355) 77471..78579 + 1109 WP_226538046.1 IS3 family transposase -
N4838_RS21285 (N4838_021360) 79032..80255 - 1224 WP_284183215.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 / aadA2 / aph(3')-Ia / aac(3)-IVa / aph(4)-Ia / sul2 / floR / aac(6')-Ib-cr / ARR-3 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / tet(B) - 1..129473 129473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12097.88 Da        Isoelectric Point: 7.0813

>T278793 WP_023159957.1 NZ_CP123252:75516-75848 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8800.23 Da        Isoelectric Point: 5.0508

>AT278793 WP_096864992.1 NZ_CP123252:75271-75516 [Providencia rettgeri]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLENLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P1BQ75

Antitoxin

Source ID Structure

References