Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-dnstrm_HI1420 |
| Location | 4442791..4443374 | Replicon | chromosome |
| Accession | NZ_CP123251 | ||
| Organism | Providencia rettgeri strain YZLc5-3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N4838_RS20380 | Protein ID | WP_096863599.1 |
| Coordinates | 4443072..4443374 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4838_RS20375 | Protein ID | WP_004265229.1 |
| Coordinates | 4442791..4443075 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4838_RS20350 (N4838_020415) | 4437951..4438928 | - | 978 | WP_004265237.1 | 6-phosphofructokinase | - |
| N4838_RS20355 (N4838_020420) | 4439335..4440279 | - | 945 | WP_102140623.1 | phosphatidate cytidylyltransferase | - |
| N4838_RS20360 (N4838_020425) | 4440276..4440917 | - | 642 | WP_140172874.1 | lysophospholipid acyltransferase family protein | - |
| N4838_RS20365 (N4838_020430) | 4441155..4441907 | - | 753 | WP_004907010.1 | M48 family metallopeptidase | - |
| N4838_RS20370 (N4838_020435) | 4442127..4442708 | - | 582 | WP_094961882.1 | HutD family protein | - |
| N4838_RS20375 (N4838_020440) | 4442791..4443075 | - | 285 | WP_004265229.1 | putative addiction module antidote protein | Antitoxin |
| N4838_RS20380 (N4838_020445) | 4443072..4443374 | - | 303 | WP_096863599.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4838_RS20385 (N4838_020450) | 4443619..4444188 | - | 570 | WP_215954265.1 | Spy/CpxP family protein refolding chaperone | - |
| N4838_RS20390 (N4838_020455) | 4444339..4445037 | + | 699 | WP_004265224.1 | envelope stress response regulator transcription factor CpxR | - |
| N4838_RS20395 (N4838_020460) | 4445034..4446404 | + | 1371 | WP_215954266.1 | envelope stress sensor histidine kinase CpxA | - |
| N4838_RS20400 (N4838_020465) | 4446878..4448314 | + | 1437 | WP_239354294.1 | capsule assembly Wzi family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11433.37 Da Isoelectric Point: 10.0723
>T278791 WP_096863599.1 NZ_CP123251:c4443374-4443072 [Providencia rettgeri]
MITVLTTECFDSWIKNLRDIRAKTKILMRIRRLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
MITVLTTECFDSWIKNLRDIRAKTKILMRIRRLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|