Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4264949..4265492 | Replicon | chromosome |
| Accession | NZ_CP123251 | ||
| Organism | Providencia rettgeri strain YZLc5-3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N4838_RS19480 | Protein ID | WP_262961201.1 |
| Coordinates | 4264949..4265248 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4838_RS19485 | Protein ID | WP_196725047.1 |
| Coordinates | 4265238..4265492 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4838_RS19450 (N4838_019515) | 4260496..4261782 | - | 1287 | WP_112308117.1 | N-acetylmuramoyl-L-alanine amidase AmiB | - |
| N4838_RS19455 (N4838_019520) | 4261797..4262261 | - | 465 | WP_004906013.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| N4838_RS19460 (N4838_019525) | 4262550..4263731 | + | 1182 | WP_136134035.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| N4838_RS19480 (N4838_019545) | 4264949..4265248 | - | 300 | WP_262961201.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4838_RS19485 (N4838_019550) | 4265238..4265492 | - | 255 | WP_196725047.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N4838_RS19490 (N4838_019555) | 4265677..4266222 | - | 546 | WP_196725048.1 | oligoribonuclease | - |
| N4838_RS19495 (N4838_019560) | 4266334..4267386 | + | 1053 | WP_004906021.1 | small ribosomal subunit biogenesis GTPase RsgA | - |
| N4838_RS19500 (N4838_019565) | 4267543..4268439 | + | 897 | WP_136134032.1 | archaetidylserine decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11862.04 Da Isoelectric Point: 10.2463
>T278790 WP_262961201.1 NZ_CP123251:c4265248-4264949 [Providencia rettgeri]
MIFDIVFDERALREWKKLDYSIREQFKKKLKKLKKLQLNPYIESLRLHGELSNCYKIKLRASGFRLVYQVVDDEIVIFVV
AVGKREDKKVYNSAIERLP
MIFDIVFDERALREWKKLDYSIREQFKKKLKKLKKLQLNPYIESLRLHGELSNCYKIKLRASGFRLVYQVVDDEIVIFVV
AVGKREDKKVYNSAIERLP
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|