Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 4194868..4195576 | Replicon | chromosome |
Accession | NZ_CP123251 | ||
Organism | Providencia rettgeri strain YZLc5-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N4838_RS19125 | Protein ID | WP_262960865.1 |
Coordinates | 4195208..4195576 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N4838_RS19120 | Protein ID | WP_004905885.1 |
Coordinates | 4194868..4195197 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4838_RS19105 (N4838_019175) | 4190938..4191909 | - | 972 | WP_004905881.1 | efflux RND transporter periplasmic adaptor subunit | - |
N4838_RS19110 (N4838_019180) | 4192442..4194127 | + | 1686 | WP_094961673.1 | sensor histidine kinase | - |
N4838_RS19115 (N4838_019185) | 4194147..4194863 | + | 717 | WP_004905884.1 | two-component system response regulator BtsR | - |
N4838_RS19120 (N4838_019190) | 4194868..4195197 | - | 330 | WP_004905885.1 | helix-turn-helix domain-containing protein | Antitoxin |
N4838_RS19125 (N4838_019195) | 4195208..4195576 | - | 369 | WP_262960865.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4838_RS19130 (N4838_019200) | 4195730..4197661 | - | 1932 | WP_110591058.1 | DEAD/DEAH family ATP-dependent RNA helicase | - |
N4838_RS19135 (N4838_019205) | 4197832..4198749 | - | 918 | WP_262960864.1 | lipoprotein NlpI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13714.02 Da Isoelectric Point: 9.9893
>T278789 WP_262960865.1 NZ_CP123251:c4195576-4195208 [Providencia rettgeri]
VAFYKISSFKRSTKKIKIMDKHLLKATNEVLAGVYEADLGSGVIKKRIAINGKGKSGGVRVIIFFKVSHHLFFADGWEKC
NIAAKGVKEIEDDELDAYKNLSRLFLNYTDDKIADLVLHNIL
VAFYKISSFKRSTKKIKIMDKHLLKATNEVLAGVYEADLGSGVIKKRIAINGKGKSGGVRVIIFFKVSHHLFFADGWEKC
NIAAKGVKEIEDDELDAYKNLSRLFLNYTDDKIADLVLHNIL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|