Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 2949260..2949795 | Replicon | chromosome |
| Accession | NZ_CP123251 | ||
| Organism | Providencia rettgeri strain YZLc5-3 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4BV22 |
| Locus tag | N4838_RS13295 | Protein ID | WP_004255694.1 |
| Coordinates | 2949487..2949795 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | D4BV21 |
| Locus tag | N4838_RS13290 | Protein ID | WP_004255691.1 |
| Coordinates | 2949260..2949487 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4838_RS13270 (N4838_013305) | 2944542..2944982 | + | 441 | WP_110591516.1 | flagellar export chaperone FlgN | - |
| N4838_RS13275 (N4838_013310) | 2945169..2945600 | + | 432 | WP_140170720.1 | hypothetical protein | - |
| N4838_RS13280 (N4838_013315) | 2945753..2947852 | - | 2100 | WP_004255687.1 | flagellar biosynthesis protein FlhA | - |
| N4838_RS13285 (N4838_013320) | 2947845..2948996 | - | 1152 | WP_140170721.1 | flagellar biosynthesis protein FlhB | - |
| N4838_RS13290 (N4838_013325) | 2949260..2949487 | + | 228 | WP_004255691.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| N4838_RS13295 (N4838_013330) | 2949487..2949795 | + | 309 | WP_004255694.1 | CcdB family protein | Toxin |
| N4838_RS13300 (N4838_013335) | 2949811..2950368 | + | 558 | WP_004255696.1 | hypothetical protein | - |
| N4838_RS13305 (N4838_013340) | 2950411..2950617 | - | 207 | WP_272661075.1 | helix-turn-helix transcriptional regulator | - |
| N4838_RS13310 (N4838_013345) | 2950815..2951453 | - | 639 | WP_094961165.1 | protein phosphatase CheZ | - |
| N4838_RS13315 (N4838_013350) | 2951478..2951870 | - | 393 | WP_004255705.1 | chemotaxis response regulator CheY | - |
| N4838_RS13320 (N4838_013355) | 2951912..2952979 | - | 1068 | WP_262960468.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| N4838_RS13325 (N4838_013360) | 2952979..2953815 | - | 837 | WP_004255713.1 | chemotaxis protein-glutamate O-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11763.84 Da Isoelectric Point: 7.2408
>T278788 WP_004255694.1 NZ_CP123251:2949487-2949795 [Providencia rettgeri]
MQYCLYQNREDTVKYPYLLDIQSNIIDILNTRLVIPLFDSRLVKKPLPVRLNPQLSINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
MQYCLYQNREDTVKYPYLLDIQSNIIDILNTRLVIPLFDSRLVKKPLPVRLNPQLSINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D4BV22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G6Q922 |