Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1771135..1771783 | Replicon | chromosome |
Accession | NZ_CP123251 | ||
Organism | Providencia rettgeri strain YZLc5-3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N4838_RS07660 | Protein ID | WP_262961155.1 |
Coordinates | 1771598..1771783 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4838_RS07655 | Protein ID | WP_112308281.1 |
Coordinates | 1771135..1771548 (-) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4838_RS07630 (N4838_007645) | 1766450..1767586 | - | 1137 | WP_164455470.1 | M4 family metallopeptidase | - |
N4838_RS07635 (N4838_007650) | 1767745..1768662 | - | 918 | WP_004264888.1 | oxygen-dependent coproporphyrinogen oxidase | - |
N4838_RS07640 (N4838_007655) | 1768799..1769230 | + | 432 | WP_004264887.1 | GNAT family acetyltransferase | - |
N4838_RS07645 (N4838_007660) | 1769322..1769927 | + | 606 | WP_050763802.1 | RpoE-regulated lipoprotein | - |
N4838_RS07650 (N4838_007665) | 1770170..1771069 | + | 900 | WP_094961722.1 | Dyp-type peroxidase | - |
N4838_RS07655 (N4838_007670) | 1771135..1771548 | - | 414 | WP_112308281.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N4838_RS07660 (N4838_007675) | 1771598..1771783 | - | 186 | WP_262961155.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N4838_RS07665 (N4838_007680) | 1772106..1773128 | + | 1023 | WP_196732342.1 | sulfate ABC transporter substrate-binding protein | - |
N4838_RS07670 (N4838_007685) | 1773128..1773958 | + | 831 | WP_004264883.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
N4838_RS07675 (N4838_007690) | 1773958..1774818 | + | 861 | WP_004264881.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
N4838_RS07680 (N4838_007695) | 1774821..1775909 | + | 1089 | WP_004264880.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7020.21 Da Isoelectric Point: 11.1711
>T278786 WP_262961155.1 NZ_CP123251:c1771783-1771598 [Providencia rettgeri]
VQSSELINILQKNGWKLERIRGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
VQSSELINILQKNGWKLERIRGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15390.36 Da Isoelectric Point: 4.6719
>AT278786 WP_112308281.1 NZ_CP123251:c1771548-1771135 [Providencia rettgeri]
MLYTAFIEIDNDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQTLLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAVAARKELKKTD
MLYTAFIEIDNDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQTLLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAVAARKELKKTD
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|