Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1532202..1532859 | Replicon | chromosome |
Accession | NZ_CP123251 | ||
Organism | Providencia rettgeri strain YZLc5-3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A264VM08 |
Locus tag | N4838_RS06635 | Protein ID | WP_036958456.1 |
Coordinates | 1532449..1532859 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D4C097 |
Locus tag | N4838_RS06630 | Protein ID | WP_004261864.1 |
Coordinates | 1532202..1532468 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4838_RS06615 (N4838_006625) | 1529198..1530094 | - | 897 | WP_167732490.1 | hypothetical protein | - |
N4838_RS06620 (N4838_006630) | 1530339..1530959 | - | 621 | WP_004261871.1 | HD domain-containing protein | - |
N4838_RS06625 (N4838_006635) | 1530971..1531954 | - | 984 | WP_112307213.1 | tRNA-modifying protein YgfZ | - |
N4838_RS06630 (N4838_006640) | 1532202..1532468 | + | 267 | WP_004261864.1 | FAD assembly factor SdhE | Antitoxin |
N4838_RS06635 (N4838_006645) | 1532449..1532859 | + | 411 | WP_036958456.1 | protein YgfX | Toxin |
N4838_RS06640 (N4838_006650) | 1532959..1533477 | - | 519 | WP_094963000.1 | flavodoxin FldB | - |
N4838_RS06645 (N4838_006655) | 1533595..1534497 | + | 903 | WP_004261814.1 | site-specific tyrosine recombinase XerD | - |
N4838_RS06650 (N4838_006660) | 1534519..1535223 | + | 705 | WP_096863312.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N4838_RS06655 (N4838_006665) | 1535233..1536966 | + | 1734 | WP_110592137.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15568.53 Da Isoelectric Point: 10.7733
>T278785 WP_036958456.1 NZ_CP123251:1532449-1532859 [Providencia rettgeri]
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A264VM08 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A345M2Q5 |