Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 884717..885363 | Replicon | chromosome |
Accession | NZ_CP123251 | ||
Organism | Providencia rettgeri strain YZLc5-3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | B6XA97 |
Locus tag | N4838_RS03800 | Protein ID | WP_004905417.1 |
Coordinates | 884717..884920 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | D4C184 |
Locus tag | N4838_RS03805 | Protein ID | WP_004905413.1 |
Coordinates | 884995..885363 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4838_RS03775 (N4838_003780) | 880793..881131 | + | 339 | WP_004905421.1 | P-II family nitrogen regulator | - |
N4838_RS03780 (N4838_003785) | 881181..882428 | + | 1248 | WP_164456268.1 | ammonium transporter AmtB | - |
N4838_RS03785 (N4838_003790) | 882567..883436 | - | 870 | WP_036958583.1 | acyl-CoA thioesterase II | - |
N4838_RS03790 (N4838_003795) | 883675..884133 | + | 459 | WP_004905418.1 | YbaY family lipoprotein | - |
N4838_RS03800 (N4838_003805) | 884717..884920 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
N4838_RS03805 (N4838_003810) | 884995..885363 | - | 369 | WP_004905413.1 | Hha toxicity modulator TomB | Antitoxin |
N4838_RS03810 (N4838_003815) | 885887..887257 | - | 1371 | WP_094962148.1 | murein transglycosylase D | - |
N4838_RS03815 (N4838_003820) | 887339..888094 | - | 756 | WP_004905408.1 | hydroxyacylglutathione hydrolase | - |
N4838_RS03820 (N4838_003825) | 888135..888869 | + | 735 | WP_094962149.1 | methyltransferase domain-containing protein | - |
N4838_RS03825 (N4838_003830) | 888866..889336 | - | 471 | WP_004905405.1 | ribonuclease HI | - |
N4838_RS03830 (N4838_003835) | 889391..890152 | + | 762 | WP_094962150.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T278784 WP_004905417.1 NZ_CP123251:c884920-884717 [Providencia rettgeri]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14085.04 Da Isoelectric Point: 4.4915
>AT278784 WP_004905413.1 NZ_CP123251:c885363-884995 [Providencia rettgeri]
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A291E6Q2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G6Q6D9 |