Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4223324..4223919 | Replicon | chromosome |
| Accession | NZ_CP123244 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A8S7NE19 |
| Locus tag | N4691_RS20060 | Protein ID | WP_044189483.1 |
| Coordinates | 4223324..4223674 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | N4691_RS20065 | Protein ID | WP_001223208.1 |
| Coordinates | 4223668..4223919 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS20040 (4218770) | 4218770..4219792 | - | 1023 | WP_001313531.1 | ABC transporter permease | - |
| N4691_RS20045 (4219806) | 4219806..4221308 | - | 1503 | WP_062892934.1 | sugar ABC transporter ATP-binding protein | - |
| N4691_RS20050 (4221448) | 4221448..4222404 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N4691_RS20055 (4222714) | 4222714..4223244 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| N4691_RS20060 (4223324) | 4223324..4223674 | - | 351 | WP_044189483.1 | endoribonuclease toxin ChpB | Toxin |
| N4691_RS20065 (4223668) | 4223668..4223919 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N4691_RS20070 (4224131) | 4224131..4224472 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N4691_RS20075 (4224475) | 4224475..4228254 | - | 3780 | WP_062892753.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12541.47 Da Isoelectric Point: 5.6219
>T278772 WP_044189483.1 NZ_CP123244:c4223674-4223324 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASSHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASSHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|