Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1104194..1104777 | Replicon | chromosome |
Accession | NZ_CP123244 | ||
Organism | Escherichia coli strain YZMc3-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N4691_RS05330 | Protein ID | WP_000254738.1 |
Coordinates | 1104442..1104777 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N4691_RS05325 | Protein ID | WP_000581937.1 |
Coordinates | 1104194..1104442 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4691_RS05315 (1100533) | 1100533..1101834 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N4691_RS05320 (1101882) | 1101882..1104116 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N4691_RS05325 (1104194) | 1104194..1104442 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N4691_RS05330 (1104442) | 1104442..1104777 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N4691_RS05335 (1104848) | 1104848..1105639 | + | 792 | WP_001071665.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N4691_RS05340 (1105867) | 1105867..1107504 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N4691_RS05345 (1107592) | 1107592..1108890 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T278762 WP_000254738.1 NZ_CP123244:1104442-1104777 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|