Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 948970..949624 | Replicon | chromosome |
| Accession | NZ_CP123244 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | N4691_RS04630 | Protein ID | WP_000244777.1 |
| Coordinates | 949217..949624 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N4691_RS04625 | Protein ID | WP_000354046.1 |
| Coordinates | 948970..949236 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS04605 (945058) | 945058..946491 | - | 1434 | WP_021557183.1 | 6-phospho-beta-glucosidase BglA | - |
| N4691_RS04610 (946536) | 946536..946847 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N4691_RS04615 (947011) | 947011..947670 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N4691_RS04620 (947747) | 947747..948727 | - | 981 | WP_001625883.1 | tRNA-modifying protein YgfZ | - |
| N4691_RS04625 (948970) | 948970..949236 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N4691_RS04630 (949217) | 949217..949624 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| N4691_RS04635 (949664) | 949664..950185 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N4691_RS04640 (950297) | 950297..951193 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N4691_RS04645 (951218) | 951218..951928 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N4691_RS04650 (951934) | 951934..953667 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T278761 WP_000244777.1 NZ_CP123244:949217-949624 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |