Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 814250..815048 Replicon chromosome
Accession NZ_CP123244
Organism Escherichia coli strain YZMc3-1

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag N4691_RS03920 Protein ID WP_000854735.1
Coordinates 814250..814627 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag N4691_RS03925 Protein ID WP_032153712.1
Coordinates 814674..815048 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4691_RS03885 (809813) 809813..810991 + 1179 WP_021557196.1 type II secretion system protein GspL -
N4691_RS03890 (810993) 810993..811529 + 537 WP_000942790.1 GspM family type II secretion system protein YghD -
N4691_RS03895 (811944) 811944..812270 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4691_RS03900 (812267) 812267..812530 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
N4691_RS03905 (812602) 812602..813468 - 867 WP_032153714.1 DUF4942 domain-containing protein -
N4691_RS03910 (813553) 813553..813750 - 198 WP_000839265.1 DUF957 domain-containing protein -
N4691_RS03915 (813762) 813762..814253 - 492 WP_023155722.1 DUF5983 family protein -
N4691_RS03920 (814250) 814250..814627 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
N4691_RS03925 (814674) 814674..815048 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N4691_RS03930 (815128) 815128..815349 - 222 WP_000692345.1 DUF987 domain-containing protein -
N4691_RS03935 (815418) 815418..815894 - 477 WP_001186715.1 RadC family protein -
N4691_RS03940 (815910) 815910..816395 - 486 WP_032153711.1 antirestriction protein -
N4691_RS03945 (816487) 816487..817305 - 819 WP_021543391.1 DUF932 domain-containing protein -
N4691_RS03950 (817395) 817395..817628 - 234 WP_001278287.1 DUF905 family protein -
N4691_RS03955 (817634) 817634..818311 - 678 WP_001097302.1 hypothetical protein -
N4691_RS03960 (818459) 818459..819139 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 811944..877906 65962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T278760 WP_000854735.1 NZ_CP123244:c814627-814250 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT278760 WP_032153712.1 NZ_CP123244:c815048-814674 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References