Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 106041..106666 | Replicon | plasmid pYZLc1-3_160k |
Accession | NZ_CP123241 | ||
Organism | Escherichia coli strain YZLc1-3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4725_RS25805 | Protein ID | WP_000911313.1 |
Coordinates | 106268..106666 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | N4725_RS25800 | Protein ID | WP_000450520.1 |
Coordinates | 106041..106268 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4725_RS25800 (106041) | 106041..106268 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4725_RS25805 (106268) | 106268..106666 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4725_RS25810 (106675) | 106675..108828 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
N4725_RS25815 (109081) | 109081..109812 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
N4725_RS25820 (109844) | 109844..110341 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / dfrA12 / aadA2 / qacE / mph(A) / aph(3')-Ia / aac(3)-IId / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..160923 | 160923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T278754 WP_000911313.1 NZ_CP123241:106268-106666 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|